Web Hosting Plans | Registrazione Domini | Server Dedicati | Multi Domain Hosting Plans | EUROPEAN DEDICATED SERVER | VPS | DEDICATED SERVER IN EUROPE

ENGLISH SPANISH ITALIAN
Chi siamo Servizi Area riservata Supporto WebMail Contatti
HOMEPAGE SITEMAP EMAIL
EUROPEANWEBHOST.COM - SERVIZI

Europeanwebhost nel vasto del mercato di internet è nota per la sua varietà di opzioni offerte al cliente. Ogni cliente che ha scelto i nostri servizi lo ha fatto la professionalità e la qualità dei servizi offerti. Tra i principali servizi offerti dal nostro team di professionisti ci sono:

WEB HOSTING

Europeanwebhost con quattro pacchetti hosting windows e hosting linux è in grado di soddisfare ogni singola esigenza. I piani hosting sono stati pensati per soddisfare le più comuni esigenze. Molte società tra le più competitive del settore, hanno pensato di copiare le nostre soluzioni dato il crescente gradimento avuto nel settore.

Le nostre soluzioni hosting windows e hosting linux sono ideali per un servizio sicuro e professionale. Ogni spazio web, è fornito dio un pannello di controllo. Per hosting windows è fornito il pannello di controllo HELM, mentre per hosting linux è fornito di pannello di controllo PLESK.
Attraverso il pannello di controllo si potranno amministrare i propri siti, caselle mail, database, utenze ftp, ip dedicati, cartelle protette, permessi ecc. L'obbiettivo di Europeanwebhost è quello di fornire soluzioni web hosting windows e hosting linux di fascia alta a prezzi concorrenziali e di rendere autonomo il cliente nelle operazioni più comuni.

PROTEGGI I TUOI DATI

Ogni proprietario di un nome a dominio è tenuto ad indicare i propri dati personali reali, compreso il nome, l'indirizzo, il numero di telefono e l'indirizzo email. Queste informazioni sono memorizzate in un database di pubblico accesso. Europeanwebhost vi fornisce la possibilità di acquistare insieme al vostro dominio l'opzione “protezione dati whois” che nasconderà da occhi indiscreti i vostri dati personali. Voi rimarrete i reali proprietari del dominio ma i dati registrant, technical, admin e fatturazione visibili da un normalissimo whois, non saranno i vostri!

NB: l'opzione “protezione dati whois” non può essere applicata a tutti i domini.

GESTIONE DNS o URL FORWARDING

La registrazione di qualsiasi nome a dominio come ad esempio .it - .com - .net - .org - .biz - .info - .eu comprende un pannello di amministrazione per la gestione dei dns e url forwarding avendo così la possibilità di far puntare il dominio ed email su un altro spazio web.

Il costo del piano hosting redirect+dns comprende la registrazione e mantenimento di un dominio con estensione .it - .com - .net - .org - .biz - .info - .eu intestato a tuo nome.

REALIZZAZIONE SITI E PORTALI

Europeanwebhost realizza siti e portali in differenti linguaggi di programmazione (ASP, PHP, ASPNET) con il supporto di programmatori e grafici professionali con un ampio curriculum alle spalle.

I siti possono includere su richiesta le certificazioI siti possono includere su richiesta le certificazioni BancaSella per una gestione sicura ed affidabile delle transazioni in rete, e garantendo ai clienti efficienti sistemi di protezione della privacy e crittografazione dei dati.

Per un preventivo gratuito mandate le vostre richieste al seguente form di contatto

SERVIZIO STESURA TESTI

Europeanwebhost fornisce tra i suoi servizi la stesura di testi per q fornisce tra i suoi servizi la stesura di testi per qualsiasi genere o tipologia, integrando i contenuti con argomenti originali ed adatti a diverse esigenze. I nostri web writing hanno una maturata esperienza nel settore e strutturano il testo in base a keyword appropriate e finalizzate ad una corretta indicizzazione.

Mentre qui di seguito trovate i prezzi suddivisi per numero di righe e di caratteri:

  • 13 righe (conteggiate con word* carattere times new roman, dimensione 12 – caratteri 1.300 circa, spazi inclusi) 3,50 euro 20 righe (conteggiate con word*: carattere times new roman, dimensione 12 – caratteri 1.990 circa, spazi inclusi) 5,40 euro
  • 30 righe (conteggiate con word*: carattere times new roman, dimensione 12 - caratteri 3.000 circa, spazi inclusi) 8,00 euro.

Per un preventivo gratuito mandate le vostre richieste al seguente form di contatto.

Rimane inteso che nella stesura del testo si è molto flessibili. Eventuali variazioni minime verranno comunque valutate nel range di prezzi sopra indicati.
* per il conteggio fare riferimento alla funzione “Conteggio parole” presente nel menù Strumenti del pacchetto Office.

TRADUZIONI

Europeanwebhost realizza anche traduzioni in Inglese, Francese, Spagnolo e Tedesco avvalendosi di professionisti madrelingua e collaboratori con notevole esperienza nel settore.

Ecco i prezzi per pacchetto e suddivisi in base alla differenti tipologie di traduzione.

Pacchetto Inglese
4 euro per ogni cartella* (dall'inglese all'italiano)
6 euro per ogni cartella* (dall'italiano all'inglese)

Pacchetto Francese
4 euro per ogni cartella* (dal francese all'italiano)
7 euro per ogni cartella* (dall'italiano al francese)

Pacchetto Spagnolo
4 euro per ogni cartella* (dallo spagnolo all'italiano)
7 euro per ogni cartella* (dall'italiano allo spagnolo)

Pacchetto Tedesco
4 euro per ogni cartella* (dal tedesco all'italiano)
7 euro per ogni cartella* (dall'italiano al tedesco)

Per un preventivo gratuito mandate le vostre richieste al seguente form di contatto.

Eventuali variazioni minime saranno comunque conteggiate nei pacchetti sopra elencati.
* una cartella è formata da 1500 carateri (spazi inclusi) ossia 15 righe (font Times News Roman, carattere 12).

 

windows_server_2003centos
aspnetaspfpphpmysqlperlphpmyadmin

EUROPEANWEBHOST, S.L.
C/Atardecer 4, Ptal. A Puerta 19 � 38530 Candelaria (S.C. de Tenerife)
Registro Mercantil de S.C. de Tenerife � Tomo 3225 � Folio 31 � Hoja TF-49963 � Inscripción 1 � CIF B76568591