Web Hosting Plans | Registrazione Domini | Server Dedicati | Multi Domain Hosting Plans | EUROPEAN DEDICATED SERVER | VPS | DEDICATED SERVER IN EUROPE

ENGLISH SPANISH ITALIAN
Chi siamo Servizi Area riservata Supporto WebMail Contatti
HOMEPAGE SITEMAP EMAIL
EUROPEANWEBHOST.COM - VPS
I nostri VPS di tipo full managed rappresentano la soluzione ideale per il professionista che non si accontenta dell'hosting condiviso ma che non intende neanche affrontare i costi di un server dedicato.
Essi costituiscono infatti un ambiente completamente isolato all'interno di un server , e sono dotati di caratteristiche paragonabili a quelle di un vero e proprio server dedicato.
Dispongono inoltre di una propria memoria RAM (inaccessibile dagli altri VPS), di un proprio filesystem, di una scheda di rete virtuale con 2 indirizzi IP dedicati, etc.
VPS
OS
Traffico
RAM
Burst RAM
Hard Disk
IPs
Prezzo
WHITE
CentOS
200GB
256MB
512MB
10GB
2
40€
YELLOW
CentOS
350GB
384MB
1GB
20GB
2
50€
GREEN
CentOS
450GB
512MB
1.5GB
30GB
2
60€
RED
CentOS
550GB
768MB
2GB
40GB
2
70€
BLACK
CentOS
650GB
1GB
4GB
50GB
2
80€

Ogni servizio è incluso dei seguenti servizi:

  • httpd monitoring
  • Business Continuance Protection

Costi di 5 euro per ogni opzione aggiuntiva per:

  • Plesk Unlimited domains
  • Plesk Power Pack

Tecnologia di virtualizzazione Virtuozzo, pannello di controllo Plesk
Uplink 100mps o 1000mpbs se il carico di lavoro supera il 30%

windows_server_2003centos
aspnetaspfpphpmysqlperlphpmyadmin

EUROPEANWEBHOST, S.L.
C/Atardecer 4, Ptal. A Puerta 19 � 38530 Candelaria (S.C. de Tenerife)
Registro Mercantil de S.C. de Tenerife � Tomo 3225 � Folio 31 � Hoja TF-49963 � Inscripción 1 � CIF B76568591